Recombinant Human NAP-2 (rHuNAP-2/CXCL7)

Artikelnummer: BWT-PR1101
Artikelname: Recombinant Human NAP-2 (rHuNAP-2/CXCL7)
Artikelnummer: BWT-PR1101
Hersteller Artikelnummer: PR1101
Alternativnummer: BWT-PR1101-2UG,BWT-PR1101-10UG,BWT-PR1101-1.0MG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Neutrophil Activating Peptide 2 (NAP-2) is proteolytically processed carboxyl-terminal fragments of platelet basic protein (PBP) which is found in the alpha-granules of human platelets. NAP-2 is a member of the CXC chemokines. Similar to other ELR domain
Molekulargewicht: 7.6 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.
Quelle: Escherichia coli.
Reinheit: >97% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Formel: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio