Recombinant Human Neurotrophin-4 (rHuNT-4 )

Artikelnummer: BWT-PR1102
Artikelname: Recombinant Human Neurotrophin-4 (rHuNT-4 )
Artikelnummer: BWT-PR1102
Hersteller Artikelnummer: PR1102
Alternativnummer: BWT-PR1102-2UG,BWT-PR1102-10UG,BWT-PR1102-500UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Neurotrophin-4 (NT-4), also known as NT-5, is a member of the NGF family of neuronal and epithelial growth factors. Neurotrophins have six conserved cysteine residues that are involved in the formation of three disulfide bonds. Human NT-4 shares 48 - 52%
Molekulargewicht: 28 kDa, a noncovalently linked homodimer of two 14.0 kDa polypeptide monomers (260 total amino acid residues).
Quelle: Escherichia coli.
Reinheit: >97% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACV CTLLSRTGRA
Formel: Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio