Recombinant Human Oncostatin-M (rHuOSM)

Artikelnummer: BWT-PR1104
Artikelname: Recombinant Human Oncostatin-M (rHuOSM)
Artikelnummer: BWT-PR1104
Hersteller Artikelnummer: PR1104
Alternativnummer: BWT-PR1104-2UG,BWT-PR1104-10UG,BWT-PR1104-1.0MG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Oncostatin M (OSM) is a growth and differentiation factor that participates in the regulation of neurogenesis, osteogenesis and hematopoiesis. Produced by activated T cells, monocytes and Kaposis sarcoma cells, OSH can exert both stimulatory and inhibito
Molekulargewicht: Approximately 26.0 kDa, a single non-glycosylated polypeptide chain containing 227 amino acids.
Quelle: Escherichia coli.
Reinheit: >95% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Formel: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio