Recombinant Human Otoraplin (rHuOTOR)

Artikelnummer: BWT-PR1107
Artikelname: Recombinant Human Otoraplin (rHuOTOR)
Artikelnummer: BWT-PR1107
Hersteller Artikelnummer: PR1107
Alternativnummer: BWT-PR1107-5UG,BWT-PR1107-20UG,BWT-PR1107-500UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the MIA/OTOR family. Members of this family which also includes MIA, MIA2, and TANGO share a Src homology-3 (SH3)-like domain. OTOR is predominantly expressed in the cochlea of
Molekulargewicht: 12.7 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids.
Quelle: Escherichia coli
Reinheit: Sterile Filtered White lyophilized (freeze-dried) powder.Data Not Available.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: MVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMG VVGYFPRNLV KEQRVYQEAT KEVPTTDIDF FCE
Formel: Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio