Recombinant Human Pigment Epithelium-derived Factor (rHuPEDF)

Artikelnummer: BWT-PR1108
Artikelname: Recombinant Human Pigment Epithelium-derived Factor (rHuPEDF)
Artikelnummer: BWT-PR1108
Hersteller Artikelnummer: PR1108
Alternativnummer: BWT-PR1108-5UG,BWT-PR1108-20UG,BWT-PR1108-1.0MG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
PEDF is a noninhibitory serpin with neurotrophic, anti-angiogenic, and anti-tumorigenic properties. It is a 50 kDa glycoprotein produced and secreted in many tissues throughout the body. A major component of the anti-angiogenic action of PEDF is the indu
Molekulargewicht: Approximately 44.5 KDa, a single non-glycosylated polypeptide chain containing 400 amino acids.
Quelle: Escherichia coli.
Reinheit: >95% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: MQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSMSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSM
Formel: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.4, 150mM NaCl.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio