Recombinant Human Thrombopoietin ( rHuTPO )

Artikelnummer: BWT-PR1120
Artikelname: Recombinant Human Thrombopoietin ( rHuTPO )
Artikelnummer: BWT-PR1120
Hersteller Artikelnummer: PR1120
Alternativnummer: BWT-PR1120-2UG,BWT-PR1120-10UG,BWT-PR1120-1.0MG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Thrombopoietin (Tpo), the ligand for the receptor encoded by the c-Mpl proto-oncogene, is a key regulator of megakaryocytopoiesis and thrombopoiesis in vitro and in vivo. The cDNAs for Tpo have recently been cloned from canine, murine and human sources.
Molekulargewicht: Approximately 80 kDa, consisting of a 332 amino acid residue with a predicted molecular mass of approximately 35 kDa. As a result of glycosylation, the recombinant protein migrates with an apparent molecular mass of 8010 kDa in SDS-PAGE.
Quelle: CHO
Reinheit: >98% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDIS
Formel: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio