Recombinant Murine NOGGIN (rMuNOGGIN )

Artikelnummer: BWT-PR2032
Artikelname: Recombinant Murine NOGGIN (rMuNOGGIN )
Artikelnummer: BWT-PR2032
Hersteller Artikelnummer: PR2032
Alternativnummer: BWT-PR2032-5UG,BWT-PR2032-20UG,BWT-PR2032-1.0MG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Noggin belongs to a group of diffusible proteins which bind to ligands of the TGF-beta family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-beta ligands and their natural antagonists has major biologic
Molekulargewicht: Approximately 46.4 kDa disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains.
Quelle: Escherichia coli.
Reinheit: >95% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSV PEGMVCKPSK SVHLTVLRWR CQRRGGQRCG WIPIQYPIIS ECKCSC
Formel: Lyophilized from a 0.2µm filtered concentrated solution in 30% acetonitrile, 0.1% TFA.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Furth