Recombinant Murine Vascular Endothelial Growth Factor 120 (rMuVEGF120)

Artikelnummer: BWT-PR2037
Artikelname: Recombinant Murine Vascular Endothelial Growth Factor 120 (rMuVEGF120)
Artikelnummer: BWT-PR2037
Hersteller Artikelnummer: PR2037
Alternativnummer: BWT-PR2037-2UG,BWT-PR2037-10UG,BWT-PR2037-500UG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
VEGF was initially purified from media conditioned by normal bovine pituitary folliculo-stellate cells and by a variety of transformed cell lines as a mitogen specific for vascular endothelial cells. It was subsequently found to be identical to an indepe
Molekulargewicht: Recombinant murine VEGF120 is a 28.4 kDa disulfide-linked homodimeric protein consisting of two 121 amino acid polypeptide chains.
Quelle: Escherichia coli.
Reinheit: >96% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
Formel: Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio