Recombinant Rhesus macaque SAA1 (rRhSAA1)

Artikelnummer: BWT-PR5003
Artikelname: Recombinant Rhesus macaque SAA1 (rRhSAA1)
Artikelnummer: BWT-PR5003
Hersteller Artikelnummer: PR5003
Alternativnummer: BWT-PR5003-5UG,BWT-PR5003-20UG,BWT-PR5003-1.0MG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Serum amyloid A proteins (SAA) represents a family of apolipoproteins that circulates in association with high-density lipoproteins (HDL). The level of apo-SAA, normally 1-5 µg/ml in plasma, increases 500-1000 fold within 24 hours of an inflammatory stim
Molekulargewicht: Approximately 11.8 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids.
Quelle: Escherichia coli.
Reinheit: >97% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPGG VWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGLPEKY
Formel: Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio