Recombinant Cyclin-Dependent Kinase Inhibitor 2A (rHuP16-INK4a)

Artikelnummer: BWT-PR6001
Artikelname: Recombinant Cyclin-Dependent Kinase Inhibitor 2A (rHuP16-INK4a)
Artikelnummer: BWT-PR6001
Hersteller Artikelnummer: PR6001
Alternativnummer: BWT-PR6001-10UG,BWT-PR6001-50UG,BWT-PR6001-1.0MG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
Cyclin-dependent kinase inhibitors (CDKIs) are proteins that bind to and inhibit the activity of CDKs. Two major classes of CDK inhibitors have been identified. The p16 family (p15, p16, p18 and p19) binds to and inhibits the activities of CDK4 and CDK6.
Molekulargewicht: Approximately 16.5 kDa, a single non-glycosylated polypeptide chain containing 156 amino acids.
Quelle: Escherichia coli
Reinheit: >95% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE LGHRDVARYL RAAAGGTRGS NHARIDAAEG PSDIPD
Formel: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio