Recombinant Human Zinc finger and SCAN domain-containing protein 1 (ZSCAN1)

Produktübersicht

• Artikelname: Recombinant Human Zinc finger and SCAN domain-containing protein 1 (ZSCAN1)
• Artikelnummer: BYT-ORB1096086
• Hersteller Artikelnummer: orb1096086
• Alternativnummer: BYT-ORB1096086-20, BYT-ORB1096086-100, BYT-ORB1096086-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide

Produktbeschreibung

Recombinant Human Zinc finger and SCAN domain-containing protein 1(ZSCAN1)

Produkteigenschaften

• Molekulargewicht: 49.2 kDa
• UniProt: Q8NBB4
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MLPRPKAPASPRRPQTPTPSEQDADPGPASPRDTEAQRLRFRQFQYHVASGPHLALGQLWTLCRQWLRPEARSKEQMLELLVLEQFLGALPSKMRTWVQSQGPRSCREAASLVEDLTQMCQQEVLVSLDSVEPQDWSFGEEEDGKSPRSQKEPSQASELILDAVAAAPALPEESEWLETTQLQQSLHTRAEAEAPRAPGLLGSRARLPLKPSIWDEPEDLLAGPSSDLRAEGTVISSPKGPSAQRISPRRRNRN

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration