Recombinant Agaricus bisporus Polyphenol oxidase 2 (PPO2)

Produktübersicht

• Artikelname: Recombinant Agaricus bisporus Polyphenol oxidase 2 (PPO2)
• Artikelnummer: BYT-ORB1096088
• Hersteller Artikelnummer: orb1096088
• Alternativnummer: BYT-ORB1096088-20, BYT-ORB1096088-100, BYT-ORB1096088-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: PPO2, Phenolase 2, Cresolase 2, Tyrosinase 2

Produktbeschreibung

Recombinant Agaricus bisporus Polyphenol oxidase 2(PPO2)

Produkteigenschaften

• Molekulargewicht: 44.7 kDa
• UniProt: O42713
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Agaricus bisporus (White button mushroom)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSLIATVGPTGGVKNRLNIVDFVKNEKFFTLYVRSLELLQAKEQHDYSSFFQLAGIHGLPFTEWAKERPSMNLYKAGYCTHGQVLFPTWHRTYLSVLEQILQGAAIEVAKKFTSNQTDWVQAAQDLRQPYWDWGFELMPPDEVIKNEEVNITNYDGKKISVKNPILRYHFHPIDPSFKPYGDFATWRTTVRNPDRNRREDIPGLIKKMRLEEGQIREKTYNMLKFNDAWERFSNHGISDDQHANSLESVHDDIH

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration