Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5), partial

Produktübersicht

• Artikelname: Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5), partial
• Artikelnummer: BYT-ORB1096089
• Hersteller Artikelnummer: orb1096089
• Alternativnummer: BYT-ORB1096089-20, BYT-ORB1096089-100, BYT-ORB1096089-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: G-protein coupled receptor 49 G-protein coupled receptor 67 G-protein coupled receptor HG38

Produktbeschreibung

Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5(LGR5),partial

Produkteigenschaften

• Molekulargewicht: 66 kDa
• UniProt: O75473
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEK

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration