Recombinant Human Fructose-bisphosphate aldolase C (ALDOC)

Artikelnummer: BYT-ORB1096090
Artikelname: Recombinant Human Fructose-bisphosphate aldolase C (ALDOC)
Artikelnummer: BYT-ORB1096090
Hersteller Artikelnummer: orb1096090
Alternativnummer: BYT-ORB1096090-20, BYT-ORB1096090-100, BYT-ORB1096090-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Brain-type aldolase
Recombinant Human Fructose-bisphosphate aldolase C(ALDOC)
Molekulargewicht: 40.5 kDa
UniProt: P09972
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATV
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration