Recombinant Human Fructose-bisphosphate aldolase C(Aldoc)

Artikelnummer: BYT-ORB1096092
Artikelname: Recombinant Human Fructose-bisphosphate aldolase C(Aldoc)
Artikelnummer: BYT-ORB1096092
Hersteller Artikelnummer: orb1096092
Alternativnummer: BYT-ORB1096092-20, BYT-ORB1096092-100, BYT-ORB1096092-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Aldolase 3, Brain-type aldolase, Scrapie-responsive protein 2, Zebrin II
Recombinant Human Fructose-bisphosphate aldolase C(Aldoc)
Molekulargewicht: 40.3 kDa
UniProt: P05063
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: PHSYPALSAEQKKELSDIALRIVTPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGILVGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKKDGADFAKWRCVLKISDRTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYSPEEIAMATVT
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration