Recombinant Murine polyomavirus Major capsid protein VP1

Produktübersicht

• Artikelname: Recombinant Murine polyomavirus Major capsid protein VP1
• Artikelnummer: BYT-ORB1096097
• Hersteller Artikelnummer: orb1096097
• Alternativnummer: BYT-ORB1096097-20, BYT-ORB1096097-100, BYT-ORB1096097-500, BYT-ORB1096097-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Major structural protein VP1

Produktbeschreibung

Recombinant Murine polyomavirus Major capsid protein VP1

Produkteigenschaften

• Molekulargewicht: 42.5 kDa
• UniProt: P24595
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Murine polyomavirus (strain Kilham) (MPyV) (Murine pneumotropic virus)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: APTVKKRTSQNQGLSPQKSQNSVVVGGIQVLDVRTGPDSITQIEAFLNPRMGKPVDSDFYGFSDNITVSADYTQDMPRIKELPCYSMAKISLPMLNEDMTCDTILMWEAISCKTEVVGVSSLTNCHSAVKRLYDNEGAGFPVQGLNFHFFSVGGEALDLQWLWKNYRCNYPAGVAALQAAPKAAQVLDPKLKAKLTADGKFPIEAWSPDPAKNENTRYFGTYTGGLQTPPVLQITNTTTTILLNENGVGPLCKG

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration