Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial

Artikelnummer: BYT-ORB1096100
Artikelname: Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial
Artikelnummer: BYT-ORB1096100
Hersteller Artikelnummer: orb1096100
Alternativnummer: BYT-ORB1096100-20, BYT-ORB1096100-100, BYT-ORB1096100-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 5-HT-1D, 5-HT1D, Serotonin 1D alpha receptor, 5-HT-1D-alpha, Serotonin receptor 1D
Recombinant Human 5-hydroxytryptamine receptor 1D(HTR1D),partial
Molekulargewicht: 32.3 kDa
UniProt: P28221
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration