Recombinant Human Glutaminyl-peptide cyclotransferase (QPCT)

Artikelnummer: BYT-ORB1096101
Artikelname: Recombinant Human Glutaminyl-peptide cyclotransferase (QPCT)
Artikelnummer: BYT-ORB1096101
Hersteller Artikelnummer: orb1096101
Alternativnummer: BYT-ORB1096101-20, BYT-ORB1096101-100, BYT-ORB1096101-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Glutaminyl cyclase , QC , sQCGlutaminyl-tRNA cyclotransferaseGlutamyl cyclase , EC
Recombinant Human Glutaminyl-peptide cyclotransferase(QPCT)
Molekulargewicht: 40.4 kDa
UniProt: Q16769
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELG
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration