Recombinant Mouse Methyltransferase-like protein 10 (Mettl10)

Produktübersicht

• Artikelname: Recombinant Mouse Methyltransferase-like protein 10 (Mettl10)
• Artikelnummer: BYT-ORB1096103
• Hersteller Artikelnummer: orb1096103
• Alternativnummer: BYT-ORB1096103-20, BYT-ORB1096103-100, BYT-ORB1096103-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Methyltransferase-like protein 10, Protein-lysine N-methyltransferase Mettl10

Produktbeschreibung

Recombinant Mouse Methyltransferase-like protein 10(Mettl10)

Produkteigenschaften

• Molekulargewicht: 30.3 kDa
• UniProt: Q9D853
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mus musculus (Mouse)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MNADAEGHSGAVVPAQSPEGSSAADDFVPSALGTREHWDAVYERELRTFQEYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELVKHGFSNITGIDYSPSAIKLSASILEKEGLSNINLKVEDFLNPSTKLSGFHVCVDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAELLDAFSEGFELFEELPTPKFSFGGRSGNTVAALVFQKRGTSLDKIS

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration