Recombinant Arabidopsis thaliana Plasmodesmata-located protein 7 (PDLP7)

Produktübersicht

• Artikelname: Recombinant Arabidopsis thaliana Plasmodesmata-located protein 7 (PDLP7)
• Artikelnummer: BYT-ORB1096108
• Hersteller Artikelnummer: orb1096108
• Alternativnummer: BYT-ORB1096108-20, BYT-ORB1096108-100, BYT-ORB1096108-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cysteine-rich repeat secretory protein 60

Produktbeschreibung

Recombinant Arabidopsis thaliana Plasmodesmata-located protein 7(PDLP7)

Produkteigenschaften

• Molekulargewicht: 41.3 kDa
• UniProt: Q0WPN8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Arabidopsis thaliana(Mouse-ear cress)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: TSATDTFVFGGCSQQKFSPASAYESNLNSLLTSLVNSATYSSYNNFTIMGSSSSDTARGLFQCRGDLSMPDCATCVARAVSQVGPLCPFTCGGALQLAGCYIKYDNISFLGQEDKTVVLKKCGSSEGYNTDGISRRDAVLTELVNGGGYFRAGGSGDVQGMGQCVGDLTVSECQDCLGTAIGRLKNDCGTAVFGDMFLAKCYARYSTDGAQHYAKSHNYKTNYGGEKTFAIIIGLLAAVVLLIIFLLFLRGVCS

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration