Recombinant Chicken Lysozyme C (LYZ) (E53A)

Artikelnummer: BYT-ORB1096110
Artikelname: Recombinant Chicken Lysozyme C (LYZ) (E53A)
Artikelnummer: BYT-ORB1096110
Hersteller Artikelnummer: orb1096110
Alternativnummer: BYT-ORB1096110-20, BYT-ORB1096110-100, BYT-ORB1096110-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 1,4-beta-N-acetylmuramidase C, Allergen Gal d IV, Gal d 4
Recombinant Chicken Lysozyme C(LYZ)(E53A)
Molekulargewicht: 14.4 kDa
UniProt: P00698
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Gallus gallus (Chicken)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFASNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration