Recombinant Human Protein Wiz (WIZ), partial

Artikelnummer: BYT-ORB1096112
Artikelname: Recombinant Human Protein Wiz (WIZ), partial
Artikelnummer: BYT-ORB1096112
Hersteller Artikelnummer: orb1096112
Alternativnummer: BYT-ORB1096112-20, BYT-ORB1096112-100, BYT-ORB1096112-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Widely-interspaced zinc finger-containing protein, Zinc finger protein 803
Recombinant Human Protein Wiz(WIZ),partial
Molekulargewicht: 28.0 kDa
UniProt: O95785
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RCEFCGEFFENRKGLSSHARSHLRQMGVTEWSVNGSPIDTLREILKKKSKPCLIKKEPPAGDLAPALAEDGPPTVAPGPVQSPLPLSPLAGRPGKPGAGPAQVPRELSLTPITGAKPSATGYLGSVAAKRPLQEDRLLPAEVKAKTYIQTELPFKAKTLHEKTSHSSTEACCELCGLYFENRKALASHARAH
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration