Recombinant Lys-gingipain W83(kgp),partial

Produktübersicht

• Artikelname: Recombinant Lys-gingipain W83(kgp),partial
• Artikelnummer: BYT-ORB1096122
• Hersteller Artikelnummer: orb1096122
• Alternativnummer: BYT-ORB1096122-20, BYT-ORB1096122-100, BYT-ORB1096122-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Lysine specific cysteine protease, Lysine-specific cysteine proteinase, Porphypain, PrtK48

Produktbeschreibung

Recombinant Lys-gingipain W83(kgp),partial

Produkteigenschaften

• Molekulargewicht: 51.6 kDa
• UniProt: Q51817
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Porphyromonas gingivalis
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DVYTDHGDLYNTPVRMLVVAGAKFKEALKPWLTWKAQKGFYLDVHYTDEAEVGTTNASIKAFIHKKYNDGLAASAAPVFLALVGDTDVISGEKGKKTKKVTDLYYSAVDGDYFPEMYTFRMSASSPEELTNIIDKVLMYEKATMPDKSYLEKVLLIAGADYSWNSQVGQPTIKYGMQYYYNQEHGYTDVYNYLKAPYTGCYSHLNTGVSFANYTAHGSETAWADPLLTTSQLKALTNKDKYFLAIGNCCITAQF

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration