Recombinant Human Interferon regulatory factor 1 (IRF1) (K29R)

Produktübersicht

• Artikelname: Recombinant Human Interferon regulatory factor 1 (IRF1) (K29R)
• Artikelnummer: BYT-ORB1096124
• Hersteller Artikelnummer: orb1096124
• Alternativnummer: BYT-ORB1096124-20, BYT-ORB1096124-100, BYT-ORB1096124-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: IRF-1

Produktbeschreibung

Recombinant Human Interferon regulatory factor 1(IRF1)(K29R)

Produkteigenschaften

• Molekulargewicht: 41.5 kDa
• UniProt: P10914
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MPITRMRMRPWLEMQINSNQIPGLIWINREEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGK

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration