Recombinant Human herpesvirus 2 Envelope glycoprotein E (gE)

Produktübersicht

• Artikelname: Recombinant Human herpesvirus 2 Envelope glycoprotein E (gE)
• Artikelnummer: BYT-ORB1096128
• Hersteller Artikelnummer: orb1096128
• Alternativnummer: BYT-ORB1096128-20, BYT-ORB1096128-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: gE, gE-2

Produktbeschreibung

Recombinant Human herpesvirus 2 Envelope glycoprotein E(gE)

Produkteigenschaften

• Molekulargewicht: 60.1 kDa
• UniProt: P89475
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AAPRTSWKRVTSGEDVVLLPAPAERTRAHKLLWAAEPLDACGPLRPSWVALWPPRRVLETVVDAACMRAPEPLAIAYSPPFPAGDEGLYSELAWRDRVAVVNESLVIYGALETDSGLYTLSVVGLSDEARQVASVVLVVEPAPVPTPTPDDYDEEDDAGVTNARRSAFPPQPPPRRPPVAPPTHPRVIPEVSHVRGVTVHMETLEAILFAPGETFGTNVSIHAIAHDDGPYAMDVVWMRFDVPSSCADMRIYEA

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration