Recombinant Bovine Leukocyte antigen CD37 (CD37)

Produktübersicht

• Artikelname: Recombinant Bovine Leukocyte antigen CD37 (CD37)
• Artikelnummer: BYT-ORB1096129
• Hersteller Artikelnummer: orb1096129
• Alternativnummer: BYT-ORB1096129-20, BYT-ORB1096129-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: CD37

Produktbeschreibung

Recombinant Bovine Leukocyte antigen CD37(CD37)

Produkteigenschaften

• Molekulargewicht: 37.8 kDa
• UniProt: Q2KHY8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Bos taurus (Bovine)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSAHDGCLSLVKYLLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLSFMPLQIWSKVLAVSGILTMGLALLGCVGALKEFRCLLGLYFGTLLLLFATQITLGILISTQRVQLKKKVKDVVQKTIQNYRTHPEETAAEESWDYVQFQLRCCGWESPQDWFHIPSMRRNESEGDRVPCSCYNSSATNDSTIFDKISPQFSRLGSLAQPRHNVEVCSVPANSYIYQQGCERNLSNWLTNNLISIVGICLGVGLL

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration