Recombinant Human C-C chemokine receptor type 8 (CCR8), partial,Nanodiscs

Produktübersicht

• Artikelname: Recombinant Human C-C chemokine receptor type 8 (CCR8), partial,Nanodiscs
• Artikelnummer: BYT-ORB1096131
• Hersteller Artikelnummer: orb1096131
• Alternativnummer: BYT-ORB1096131-20, BYT-ORB1096131-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: CC chemokine receptor CHEMR1, CMKBRL2Chemokine receptor-like 1, CKR-L1, GPR-CY6, GPRCY6, TER1, CDw198

Produktbeschreibung

Recombinant Human C-C chemokine receptor type 8(CCR8),partial,Nanodiscs

Produkteigenschaften

• Molekulargewicht: 9.4 kDa
• UniProt: P51685
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: LLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSV

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration