Recombinant Bovine coronavirus Nucleoprotein (N)

Artikelnummer: BYT-ORB1096655
Artikelname: Recombinant Bovine coronavirus Nucleoprotein (N)
Artikelnummer: BYT-ORB1096655
Hersteller Artikelnummer: orb1096655
Alternativnummer: BYT-ORB1096655-20, BYT-ORB1096655-100, BYT-ORB1096655-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Nucleocapsid protein, NC, Protein N
Recombinant Bovine coronavirus Nucleoprotein(N)
Molekulargewicht: 51.5 kDa
UniProt: P26020
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Bovine coronavirus (strain OK-0514) (BCoV) (BCV)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSFTPGKQSSSRASSGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQV
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration