Recombinant Bovine coronavirus Non-structural protein 2a (2a)

Produktübersicht

• Artikelname: Recombinant Bovine coronavirus Non-structural protein 2a (2a)
• Artikelnummer: BYT-ORB1096663
• Hersteller Artikelnummer: orb1096663
• Alternativnummer: BYT-ORB1096663-20, BYT-ORB1096663-100, BYT-ORB1096663-500, BYT-ORB1096663-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: ns2a, 32 kDa accessory protein, 32 kDa non-structural protein, ns2

Produktbeschreibung

Recombinant Bovine coronavirus Non-structural protein 2a(2a)

Produkteigenschaften

• Molekulargewicht: 37.6 kDa
• UniProt: P0C2R3
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Bovine coronavirus (strain LSU-94LSS-051) (BCoV-LSU) (BCV)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MAVAYADKPNHFINFPLTQFQGFVLNYKGLQFQLLDEGVDCKIQTAPHISLAMLDIQPEDYRSVDVAIQEVIDDMHWGEGFQIKFENPHILGRCIVLDVKGVEELHDDLVNYIRDKGCVADQSRKWIGHCTIAQLTDAALSIKENVDFINSMQFNYKITINPSSPARLEIVKLGAEKKDGFYETIASHWMGIRFEYNPPTDKLAMIMGYCCSEVVRKELEEGDLPENDDDAWFKLSYHYENNSWFFRHVYRKSS

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration