Recombinant Bovine coronavirus Non-structural protein 2a (2a)

Produktübersicht

• Artikelname: Recombinant Bovine coronavirus Non-structural protein 2a (2a)
• Artikelnummer: BYT-ORB1096664
• Hersteller Artikelnummer: orb1096664
• Alternativnummer: BYT-ORB1096664-20, BYT-ORB1096664-100, BYT-ORB1096664-500, BYT-ORB1096664-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: ns2a, 32 kDa accessory protein, 32 kDa non-structural protein, ns2

Produktbeschreibung

Recombinant Bovine coronavirus Non-structural protein 2a(2a)

Produkteigenschaften

• Molekulargewicht: 37.7 kDa
• UniProt: Q91A27
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Bovine coronavirus (strain 98TXSF-110-ENT) (BCoV-ENT) (BCV)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MAVAYADKPNHFINFPLTQFQGFVLNYKGLQFQLLDEGVDCKIQTAPHISLAMLDIQPEDYRSVDVAIQEVIDDMHWGEGFQIKFENPHILGRCIVLDVKGVEELHDDLVNYIRDKGCVADQSRKWIGHCTIAQLTDAALSIKENVDFINNMQFNYKITINPSSPARLEIVKLGAERKDGFYETIASHWMGIRFEYNPPTDKLAMIMGYCCLEVVRKELEEGDLPENDDDAWFKLSYHYENNSWFFRHVYRKSS

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration