Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)

Artikelnummer: BYT-ORB1096669
Artikelname: Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)
Artikelnummer: BYT-ORB1096669
Hersteller Artikelnummer: orb1096669
Alternativnummer: BYT-ORB1096669-20, BYT-ORB1096669-100, BYT-ORB1096669-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ns4.8, 4.8 kDa accessory protein
Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa(4b)
Molekulargewicht: 6.3 kDa
UniProt: P0C2R2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Bovine coronavirus (strain 98TXSF-110-LUN) (BCoV-LUN) (BCV)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MPMATTIEGADYTNIMPITVLTTVYLGVSIGIDTSTTGFTCFSRY
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration