Recombinant Bovine coronavirus Spike glycoprotein (S), partial

Produktübersicht

• Artikelname: Recombinant Bovine coronavirus Spike glycoprotein (S), partial
• Artikelnummer: BYT-ORB1096670
• Hersteller Artikelnummer: orb1096670
• Alternativnummer: BYT-ORB1096670-20, BYT-ORB1096670-100, BYT-ORB1096670-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: S glycoprotein, E2, Peplomer protein

Produktbeschreibung

Recombinant Bovine coronavirus Spike glycoprotein(S),partial

Produkteigenschaften

• Molekulargewicht: 36.6 kDa
• UniProt: P25192
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Bovine coronavirus (strain LY-138) (BCoV) (BCV)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTDHDVVYAQHCFKAPTNFCPCKLDGSLCVGSGSGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAI

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration