Recombinant Bovine coronavirus Non-structural protein 2a (2a)

Artikelnummer: BYT-ORB1096677
Artikelname: Recombinant Bovine coronavirus Non-structural protein 2a (2a)
Artikelnummer: BYT-ORB1096677
Hersteller Artikelnummer: orb1096677
Alternativnummer: BYT-ORB1096677-20, BYT-ORB1096677-100, BYT-ORB1096677-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ns2a, 32 kDa accessory protein, 32 kDa non-structural protein, ns2
Recombinant Bovine coronavirus Non-structural protein 2a(2a)
Molekulargewicht: 33.7 kDa
UniProt: Q91A27
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Bovine coronavirus (strain 98TXSF-110-ENT) (BCoV-ENT) (BCV)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAVAYADKPNHFINFPLTQFQGFVLNYKGLQFQLLDEGVDCKIQTAPHISLAMLDIQPEDYRSVDVAIQEVIDDMHWGEGFQIKFENPHILGRCIVLDVKGVEELHDDLVNYIRDKGCVADQSRKWIGHCTIAQLTDAALSIKENVDFINNMQFNYKITINPSSPARLEIVKLGAERKDGFYETIASHWMGIRFEYNPPTDKLAMIMGYCCLEVVRKELEEGDLPENDDDAWFKLSYHYENNSWFFRHVYRKSS
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration