Recombinant Human coronavirus HKU1 Non-structural protein 4 (4)

Produktübersicht

• Artikelname: Recombinant Human coronavirus HKU1 Non-structural protein 4 (4)
• Artikelnummer: BYT-ORB1096678
• Hersteller Artikelnummer: orb1096678
• Alternativnummer: BYT-ORB1096678-20, BYT-ORB1096678-100, BYT-ORB1096678-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Accessory protein 4 Non-structural protein of 12.5 kDa Orf4 protein

Produktbeschreibung

Recombinant Human coronavirus HKU1 Non-structural protein 4(4)

Produkteigenschaften

• Molekulargewicht: 14.1 kDa
• UniProt: Q0ZME6
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Human coronavirus HKU1 (isolate N5) (HCoV-HKU1)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MEVWRPSYKYSLITREFGVTDLEDLCFKYNYCQPCVGYCIVPLNVWCRKFGKFASYFVLRSHDTSHKNNFGVITSFTSYGNTVSEAVSKLVESASDFIAWRAEALNKYG

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration