Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein (S), partial

Produktübersicht

• Artikelname: Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein (S), partial
• Artikelnummer: BYT-ORB1096685
• Hersteller Artikelnummer: orb1096685
• Alternativnummer: BYT-ORB1096685-20, BYT-ORB1096685-100, BYT-ORB1096685-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: (S glycoprotein)(E2)(Peplomer protein)

Produktbeschreibung

Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein(S),partial

Produkteigenschaften

• Molekulargewicht: 27.2 kDa
• UniProt: P59594
• Puffer: Lyophilized from a 0.2 µm sterile fiiltered 20mM Tris-HCl,400mM NaCl,6% Trehalose,pH 7.0
• Quelle: Severe acute respiratory syndrome coronavirus (SARS-CoV)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration