Recombinant Human Novel Coronavirus Spike glycoprotein(S) (K417N),partial

Artikelnummer: BYT-ORB1096690
Artikelname: Recombinant Human Novel Coronavirus Spike glycoprotein(S) (K417N),partial
Artikelnummer: BYT-ORB1096690
Hersteller Artikelnummer: orb1096690
Alternativnummer: BYT-ORB1096690-20, BYT-ORB1096690-100, BYT-ORB1096690-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: E2 Peplomer protein
Recombinant Human Novel Coronavirus Spike glycoprotein(S) (K417N),partial
Molekulargewicht: 27.8 kDa
UniProt: P0DTC2
Puffer: Lyophilized from 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0
Quelle: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration