Recombinant Human Novel Coronavirus Spike glycoprotein(S) (N501Y),partial (Active)

Artikelnummer: BYT-ORB1096691
Artikelname: Recombinant Human Novel Coronavirus Spike glycoprotein(S) (N501Y),partial (Active)
Artikelnummer: BYT-ORB1096691
Hersteller Artikelnummer: orb1096691
Alternativnummer: BYT-ORB1096691-20, BYT-ORB1096691-100, BYT-ORB1096691-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: /
Recombinant Human Novel Coronavirus Spike glycoprotein(S) (N501Y),partial (Active)
Molekulargewicht: 55.3kDa
UniProt: P0DTC2
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Quelle: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration