Recombinant Human Novel Coronavirus Spike glycoprotein(S), partial

Produktübersicht

• Artikelname: Recombinant Human Novel Coronavirus Spike glycoprotein(S), partial
• Artikelnummer: BYT-ORB1096695
• Hersteller Artikelnummer: orb1096695
• Alternativnummer: BYT-ORB1096695-20, BYT-ORB1096695-100, BYT-ORB1096695-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: (S glycoprotein)(Peplomer protein)(Spike protein S1)(Spike protein S2)

Produktbeschreibung

Recombinant Human Novel Coronavirus Spike glycoprotein(S), partial

Produkteigenschaften

• Molekulargewicht: 93.2 kDa
• UniProt: P0DTC2
• Puffer: Lyophilized from 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0
• Quelle: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGY

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration