Mouse Tmprss2 Protein

Produktübersicht

• Artikelname: Mouse Tmprss2 Protein
• Artikelnummer: BYT-ORB1477254
• Hersteller Artikelnummer: orb1477254
• Alternativnummer: BYT-ORB1477254-20,BYT-ORB1477254-100,BYT-ORB1477254-500,BYT-ORB1477254-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: (Epitheliasin)(Plasmic transmembrane protein X)

Produktbeschreibung

Recombinant Mouse Transmembrane protease serine 2(Tmprss2),partial

Produkteigenschaften

• Molekulargewicht: 44.7 kDa
• UniProt: Q9JIQ8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mus musculus (Mouse)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: WRFWDSNCSTSEMECGSSGTCISSSLWCDGVAHCPNGEDENRCVRLYGQSFILQVYSSQRKAWYPVCQDDWSESYGRAACKDMGYKNNFYSSQGIPDQSGATSFMKLNVSSGNVDLYKKLYHSDSCSSRMVVSLRCIECGVRSVKRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPLSSPRYWTAFAGILRQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDL

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration