TPH1 / Tryptophan Hydroxylase Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB1536237
Artikelname: TPH1 / Tryptophan Hydroxylase Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB1536237
Hersteller Artikelnummer: orb1536237
Alternativnummer: BYT-ORB1536237-50
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 345-444 of human TPH1 (NP_004170.1). LSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI
Konjugation: Unconjugated
Alternative Synonym: TPH1, L-tryptophan hydroxylase, TRPH, Tryptophan 5-hydroxylase 1, Tryptophan 5-monooxygenase 1, TPRH, Tryptophan hydroxylase 1, TPH
TPH1 / Tryptophan Hydroxylase Antibody
Klonalität: Polyclonal
Konzentration: 2.135 mg/ml
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Target-Kategorie: TPH1 / Tryptophan Hydroxylase
Application Verdünnung: IHC (1:50 - 1:200), IHC-P (1:100 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung: Further information: The predicted MW is 50kDa/53kDa, while the observed MW by Western blot was 50kDa.