PVRL2 / CD112 Antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: PVRL2 / CD112 Antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: BYT-ORB1536657
• Hersteller Artikelnummer: orb1536657
• Alternativnummer: BYT-ORB1536657-50
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IF, IHC, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 382-479 of human PVRL2 (NP_002847.1). FILLRVRRRRKSPGGAGGGASGDGGFYDPKAQVLGNGDPVFWTPVVPGPMEPDGKDEEEEEEEEKAEKGLMLPPPPALEDDMESQLDGSLISRRAVYV
• Konjugation: Unconjugated
• Alternative Synonym: PVRL2, HVEB, Herpesvirus entry protein B, Poliovirus receptor-like 2, Nectin-2, PRR2, PVRR2, CD112, CD112 antigen, Herpes virus entry mediator B, Herpesvirus entry mediator B, NECTIN2

Produktbeschreibung

PVRL2 / CD112 Antibody

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.22 mg/ml
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Target-Kategorie: PVRL2 / CD112

Anwendungsbeschreibung

• Application Verdünnung: IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000)
• Anwendungsbeschreibung: Further information: The predicted MW is 51kDa/57kDa, while the observed MW by Western blot was 72kDa.