Recombinant Mesocricetus auratus Angiotensin-converting enzyme (Ace2), partial

Produktübersicht

• Artikelname: Recombinant Mesocricetus auratus Angiotensin-converting enzyme (Ace2), partial
• Artikelnummer: BYT-ORB1785123
• Hersteller Artikelnummer: orb1785123
• Alternativnummer: BYT-ORB1785123-20,BYT-ORB1785123-100,BYT-ORB1785123-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide

Produktbeschreibung

Recombinant Mesocricetus auratus Angiotensin-converting enzyme (Ace2), partial

Produkteigenschaften

• Molekulargewicht: 70.2 kDa
• UniProt: A0A1U7QTA1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mesocricetus auratus (Golden hamster)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: IIEEQAKTFLDKFNQEAEDLSYQSALASWNYNTNITEENAQKMNEAAAKWSAFYEEQSKLAKNYSLQEVQNLTIKRQLQALQQSGSSALSADKNKQLNTILNTMSTIYSTGKVCNPKNPQECLLLEPGLDDIMATSTDYNERLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARANNYEDYGDYWRGDYEAEGADGYNYNGNQLIEDVERTFKEIKPLYEQLHAYVRTKLMNTYPSYISPTGCLPAHLLGDMWGR

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration