Recombinant Human Protein C1orf43 (C1orf43), partial

Produktübersicht

• Artikelname: Recombinant Human Protein C1orf43 (C1orf43), partial
• Artikelnummer: BYT-ORB1785621
• Hersteller Artikelnummer: orb1785621
• Alternativnummer: BYT-ORB1785621-20,BYT-ORB1785621-100,BYT-ORB1785621-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: (Hepatitis C virus NS5A-transactivated protein 4)(HCV NS5A-transactivated protein 4)(Protein NICE-3)(S863-3)

Produktbeschreibung

Recombinant Human Protein C1orf43 (C1orf43), partial

Produkteigenschaften

• Molekulargewicht: 32.9 kDa
• UniProt: Q9BWL3
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: KRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSEGRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration