ACTH/POMC Antibody, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: ACTH/POMC Antibody, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: BYT-ORB182371
• Hersteller Artikelnummer: orb182371
• Alternativnummer: BYT-ORB182371-10, BYT-ORB182371-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ACTH (138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.
• Konjugation: Unconjugated
• Alternative Synonym: Pro-opiomelanocortin,POMC,Corticotropin-lipotropin,NPP,Melanotropin gamma,Gamma-MSH,Potential peptide,Corticotropin,Adrenocorticotropic hormone,ACTH,Melanotropin alpha,Alpha-MSH,Corticotropin-like intermediary peptide,CLIP,Lipotropin beta,Beta-LPH,Lipotr

Produktbeschreibung

ACTH/POMC Antibody

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
• Molekulargewicht: 29424 MW
• Sensitivitaet: > 5000 cells
• UniProt: P01189
• Formulierung: Lyophilized

Anwendungsbeschreibung

• Anwendungsbeschreibung: Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for