SARS-CoV-2 Non-structural protein 9/NSP9 Protein (Flag & hFc)

Artikelnummer: BYT-ORB1976429
Artikelname: SARS-CoV-2 Non-structural protein 9/NSP9 Protein (Flag & hFc)
Artikelnummer: BYT-ORB1976429
Hersteller Artikelnummer: orb1976429
Alternativnummer: BYT-ORB1976429-20, BYT-ORB1976429-100, BYT-ORB1976429-500
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: sars-cov-2
SARS-CoV-2 Non-structural protein 9/NSP9 Protein (Flag & hFc) is expressed in HEK293 mammalian cells with C-hFC-Flag tag. The predicted molecular weight is 44.5 kDa and the accession number is P0DTD1 YP_009742616.1.
Molekulargewicht: 44.5 kDa (predicted)
UniProt: P0DTD1
Quelle: SARS-CoV-2
Reinheit: 98.00%
Sequenz: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Anwendungsbeschreibung: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 µg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or