SARS-CoV-2 Non-structural protein 9/NSP9 Protein (His)

Artikelnummer: BYT-ORB1976430
Artikelname: SARS-CoV-2 Non-structural protein 9/NSP9 Protein (His)
Artikelnummer: BYT-ORB1976430
Hersteller Artikelnummer: orb1976430
Alternativnummer: BYT-ORB1976430-20, BYT-ORB1976430-100, BYT-ORB1976430-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: sars-cov-2
SARS-CoV-2 Non-structural protein 9/NSP9 Protein (His) is expressed in E. coli.
Molekulargewicht: 13.9 kDa (predicted)
Quelle: SARS-CoV-2
Reinheit: 98.00%
Sequenz: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Anwendungsbeschreibung: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 µg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or