SARS-CoV-2 Non-structural protein 3/NSP3 Protein (His)

Artikelnummer: BYT-ORB1976431
Artikelname: SARS-CoV-2 Non-structural protein 3/NSP3 Protein (His)
Artikelnummer: BYT-ORB1976431
Hersteller Artikelnummer: orb1976431
Alternativnummer: BYT-ORB1976431-20, BYT-ORB1976431-100, BYT-ORB1976431-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: sars-cov-2
SARS-CoV-2 Non-structural protein 3/NSP3 Protein (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 41.7 kDa and the accession number is YP_009725299.1.
Molekulargewicht: 41.7 kDa (predicted)
Quelle: SARS-CoV-2
Reinheit: 98.00%
Sequenz: EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELK
Anwendungsbeschreibung: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 µg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or