TMPRSS2 Protein, Human, Recombinant (E. coli, His)

Artikelnummer: BYT-ORB1977682
Artikelname: TMPRSS2 Protein, Human, Recombinant (E. coli, His)
Artikelnummer: BYT-ORB1977682
Hersteller Artikelnummer: orb1977682
Alternativnummer: BYT-ORB1977682-20,BYT-ORB1977682-100,BYT-ORB1977682-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Plasma membrane-anchored serine protease that participates in proteolytic cascades of relevance for the normal physiologic function of the prostate. Androgen-induced TMPRSS2 activates several substrates that include pro-hepatocyte growth factor/HGF, the
Molekulargewicht: 46.9 kDa (predicted)
UniProt: O15393
Quelle: Human
Reinheit: 98.00%
Sequenz: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND
Anwendungsbeschreibung: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.