CHRNA10 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083552
Artikelname: CHRNA10 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083552
Hersteller Artikelnummer: orb2083552
Alternativnummer: BYT-ORB2083552-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CHRNA10
Konjugation: Biotin
Alternative Synonym: CHRNA10, NACHRA10,
CHRNA10 Antibody - N-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 065135
UniProt: Q9GZZ6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGAVRWDAPA