CDKAL1 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083556
Artikelname: CDKAL1 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083556
Hersteller Artikelnummer: orb2083556
Alternativnummer: BYT-ORB2083556-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDKAL1
Konjugation: HRP
Alternative Synonym: CDKAL1,
CDKAL1 Antibody - N-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 63kDa
UniProt: Q5VV42
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: QEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWI